Protein Purification
Thermo Scientific™ Lysosome Enrichment Kit for Tissues and Cultured Cells
Enrich for lysosomes, peroxisomes and nuclei from cells and tissue with these organelle-specific subcellular fractionation kits.
Thermo Scientific™ Mitochondria Isolation Kit for Tissue
Isolate intact mitochondria from soft and hard tissue samples in about an hour with this versatile, benchtop microcentrifuge-based fractionation kit.
Invitrogen™ MagniSort™ Human CD4 Naïve T cell Enrichment Kit
Designed for the magnetic separation of CD4 naïve T cells by negative selection. It has been optimized for the isolation of human CD4 naïve T cells from normal human peripheral blood mononuclear cells utilizing a biotinylated antibody cocktail and streptavidin-coated magnetic beads.
Invitrogen™ MagniSort™ Human CD117 (c-Kit) Positive Selection Kit
Designed for the magnetic separation of CD117+ cells by positive selection. It has been optimized for the isolation of CD117+ cells from normal human peripheral blood cells.
Thermo Scientific™ Pierce™ Phosphatase Inhibitor Mini Tablets
Thermo Scientific™ Pierce Phosphatase Inhibitor Mini Tablets provide complete cell lysate and biological sample protection from dephosphorylation with a broad spectrum phosphatase inhibitor formulation.
MilliporeSigma™ Calbiochem™ Bestatin
Binds to cell surfaces and inhibits surface aminopeptidases, notably aminopeptidase B and leucine aminopeptidase.
MilliporeSigma™ Calbiochem™ Bexarotene
A retinoid X receptor (RXR) agonist that can permeate the blood-brain barrier and rapidly reduce Aβ40 and Aβ42 levels in APP/PS1 mice in an ApoE-dependent manner.
Invitrogen™ Dynabeads™ Co-Immunoprecipitation Kit
The Dynabeads™ Co-Immunoprecipitation Kit is intended for the coupling of an antibody to the surface of Dynabeads™ M-270 Epoxy beads.
MilliporeSigma™ Calbiochem™ InSolution™ APT1 Inhibitor, palmostatin B
A 50 mM (2 mg/106.23 μL) sterile-filtered solution of APT1 Inhibitor, palmostatin B in DMSO.
Grazoprevir, Thermo Scientific™
MilliporeSigma™ Calbiochem™ InSolution™ PPACK, 2HCl
A 25 mM (5 mg/357 μl) sterile-filtered solution of PPACK, 2HCl in H2O.
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
Cytiva Sephadex™ G50 Superfine Media
Use as a well established gel filtration medium for desalting and buffer exchange of biomolecules >30 000 molecular weight. Sephadex™ G50 Superfine Media's small bead size gives higher efficiency.
MilliporeSigma™ Calbiochem™ InSolution™ AMPK Inhibitor, Compound C·2HCl
The InSolution™ AMPK Inhibitor, Compound C·2HCl, also referenced under CAS 866405-64-3, controls the biological activity of AMPK. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ Phorbol-12-myristate-13-acetate
Phorbol-12-myristate-13-acetate, CAS 16561-29-8, is the most common phorbol ester. Activates PKC at nanomolar concentrations.